Tested Applications
| Positive WB detected in | mouse heart tissue, rat heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
21945-1-AP targets TOR1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16641 Product name: Recombinant human TOR1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 25-77 aa of BC015578 Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF Predict reactive species |
| Full Name | torsin family 1, member B (torsin B) |
| Calculated Molecular Weight | 336 aa, 38 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC015578 |
| Gene Symbol | TOR1B |
| Gene ID (NCBI) | 27348 |
| RRID | AB_3669382 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O14657 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Torsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TOR1B antibody 21945-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

