Tested Applications
| Positive WB detected in | A549 cells, SKOV-3 cells, U-251 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25582-1-AP targets PABPC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22216 Product name: Recombinant human PABPC5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC063113 Sequence: MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRF Predict reactive species |
| Full Name | poly(A) binding protein, cytoplasmic 5 |
| Calculated Molecular Weight | 382 aa, 43 kDa |
| Observed Molecular Weight | 37-43 kDa, 70 kDa |
| GenBank Accession Number | BC063113 |
| Gene Symbol | PABPC5 |
| Gene ID (NCBI) | 140886 |
| RRID | AB_3085806 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96DU9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PABPC5 antibody 25582-1-AP | Download protocol |
| WB protocol for PABPC5 antibody 25582-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





