Tested Applications
| Positive WB detected in | LNCaP cells, SH-SY5Y cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26807-1-AP targets TREK1/KCNK2 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25209 Product name: Recombinant human KCNK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-55 aa of BC101693 Sequence: PRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVV Predict reactive species |
| Full Name | potassium channel, subfamily K, member 2 |
| Calculated Molecular Weight | 411 aa, 46 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC101693 |
| Gene Symbol | TREK1 |
| Gene ID (NCBI) | 3776 |
| RRID | AB_3085905 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95069 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The tandem of pore domains in a weak inward rectifying K+ channel (TWIK1, K2P1.1, or KCNK1) and TWIK-related K+channel 1 (TREK1, K2P 2.1, or KCNK2) are members of the two pore domain potassium (K2P) channel family, consisting of 15 channels that regulate the stabilization of resting membrane potential and cellular excitability by wielding background K+ leakage currents (PMID:12580339). TREK1/KCNK2 is sensitive to a wide range of physical and chemical cues. Its main role is to maintain the resting potential of the cell and whilst highly expressed in the nervous system, TREK1/KCNK2 is also expressed in the kidney, heart, lung and smooth muscle cells (PMID:31031627).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TREK1/KCNK2 antibody 26807-1-AP | Download protocol |
| WB protocol for TREK1/KCNK2 antibody 26807-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
