Filter: AllWBIHCIF/ICC

WB analysis using 28678-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 28678-1-AP (SCD antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
WB analysis of A431 using 28678-1-AP
WB result of SCD antibody (28678-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SCD transfected A431 cells.
IHC staining of human liver using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse liver using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brown adipose using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse brown adipose using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded mouse brown adipose tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human ovary tumor using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human stomach cancer using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of rat heart using 28678-1-AP
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 28678-1-AP (SCD antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of MCF-7 using 28678-1-AP
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SCD antibody (28678-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

Featured Product
KD/KO Validated

SCD1 Polyclonal antibody

Name: SCD1 Polyclonal antibody
Brand: Proteintech
SKU: 28678-1-AP
Rating: 5.00 (2 reviews)

SCD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28678-1-AP

Publications(52)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

SCD, EC:1.14.19.1, Delta-9 desaturase, Delta(9)-desaturase, Delta(9) desaturase

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (52)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A431 cells, A375 cells, A549 cells, HepG2 cells
Positive IHC detected in	mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	MCF-7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:16000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 2 publications below
WB	See 48 publications below
IHC	See 6 publications below
IF	See 2 publications below
CoIP	See 1 publications below

Product Information

28678-1-AP targets SCD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat, monkey, goat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species
Full Name	stearoyl-CoA desaturase (delta-9-desaturase)
Calculated Molecular Weight	355 aa, 41 kDa
Observed Molecular Weight	28-42 kDa
GenBank Accession Number	BC005807
Gene Symbol	SCD
Gene ID (NCBI)	6319
RRID	AB_2923581
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O00767
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).

Protocols

Product Specific Protocols
IF protocol for SCD1 antibody 28678-1-AP	Download protocol
IHC protocol for SCD1 antibody 28678-1-AP	Download protocol
WB protocol for SCD1 antibody 28678-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Nature 7-Dehydrocholesterol dictates ferroptosis sensitivity Authors - Yaxu Li View Article
human,mouse	WB,IHC	Adv Sci (Weinh) Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells Authors - Ling Li View Article
mouse	WB	ACS Appl Mater Interfaces Lactate-Fueled Theranostic Nanoplatforms for Enhanced MRI-Guided Ferroptosis Synergistic with Immunotherapy of Hepatocellular Carcinoma Authors - Xiaoxiao Chen View Article
mouse	WB	Phytomedicine Melittin suppresses ovarian cancer growth by regulating SREBP1-mediated lipid metabolism Authors - Ruixin Wu View Article
human	WB	Free Radic Biol Med Zinc deficiency drives ferroptosis resistance by lactate production in esophageal squamous cell carcinoma Authors - Peiyan Yang View Article
human,mouse	WB	Inflammation Multiple Machine Learning Identifies Key Gene PHLDA1 Suppressing NAFLD Progression Authors - Zhenwei Yang View Article

Reviews

Add a review

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

FH YINGJIAN (Verified Customer) (08-07-2025)	The antibody demonstrates high specificity and strong affinity toward the target protein. Besides， the shipment very quick. It is overnight shipment. Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: liver SCD1 Antibody Western Blot validation (1:5000 dilution) in liver (Cat no:28678-1-AP)
FH Marco (Verified Customer) (07-09-2024)	It does its job in NRVCMs Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: NRVCMs