SARS-COV-2 NSP12 Polyclonal antibody

SARS-COV-2 NSP12 Polyclonal Antibody for ELISA
Cat No. 29264-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Virus and More (1)

Applications

WB, IF, ELISA

SARS-COV-2 NSP12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive ELISA detected inRecombinant protein, N/A

Recommended dilution

ApplicationDilution
Enzyme-linked Immunosorbent Assay (ELISA)ELISA : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29264-1-AP targets SARS-COV-2 NSP12 in WB, IF, ELISA applications and shows reactivity with Virus samples.

Tested Reactivity Virus
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30931

Product name: Recombinant sars-cov-2 NSP12 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of YP_009725307

Sequence: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAG

Predict reactive species
Full Name ORF1ab
GenBank Accession NumberYP_009725307
Gene Symbol SARS-COV-2 NSP8
Gene ID (NCBI) 43740578
RRIDAB_2918262
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Publications

SpeciesApplicationTitle
humanWB,IF

J Cell Biol

SARS-CoV-2 NSP3/4 control formation of replication organelle and recruitment of RNA polymerase NSP12

Authors - Jinping Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marie-Lise (Verified Customer) (12-15-2021)

very good antibody for WB with a 1/1000 dilution on Vero lysates infected with SARS-CoV-2 no background

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Vero
Loading...
||
New chat Able
正在加载,请稍候...