Tested Applications
| Positive WB detected in | A549 cells, HCT 116 cells |
| Positive IP detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30256-1-AP targets DUSP5 in WB, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32997 Product name: Recombinant human DUSP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 311-384 aa of NM_004419 Sequence: LQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC Predict reactive species |
| Full Name | dual specificity phosphatase 5 |
| Calculated Molecular Weight | 42kd |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | NM_004419 |
| Gene Symbol | DUSP5 |
| Gene ID (NCBI) | 1847 |
| RRID | AB_3669707 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16690 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DUSP5 (Dual specificity protein phosphatase 5) is also named as VH3. DUSP5, a member of DUSPs superfamily, is located in the nucleus and plays crucially regulatory roles in the signaling pathway transduction (PMID: 34169608). DUSP5 promotes the osteogenic differentiation of mesenchymal stromal cells (MSCs) by repressing SMAD1 signaling pathway in a SCP1/2‐dependent manner (PMID: 34169608). DUSP5, which specifically dephosphorylates extracellular signal-regulated kinase (ERK1/2), blocks pulmonary vascular smooth muscle cell proliferation (PMID: 34142888). DUSP5, an ERK1/2-specific endogenous phosphatase, was expressed at low levels in CRC (PMID: 36526622). DUSP5, a member of the DUSP subfamily, is known to regulate cellular inflammation (PMID: 33361528).
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for DUSP5 antibody 30256-1-AP | Download protocol |
| WB protocol for DUSP5 antibody 30256-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
