Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells | 
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 | 
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30880-1-AP targets CD147 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Eg0436 Product name: Recombinant Human CD147 protein (His Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 138-323 aa of BC009040 Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA Predict reactive species | 
                                    
| Full Name | basigin (Ok blood group) | 
| Calculated Molecular Weight | 385 aa, 42 kDa | 
| Observed Molecular Weight | 35-55 kDa | 
| GenBank Accession Number | BC009040 | 
| Gene Symbol | CD147 | 
| Gene ID (NCBI) | 682 | 
| RRID | AB_3669773 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P35613 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
CD147, also known as Basigin or extracellular matrix metalloproteinase inducer (EMMPRIN), is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 7812975). The molecule is composed of an intracellular portion, an extracellular portion and a single transmembrane region. CD147 is expressed on a variety of cell types (e.g., hematopoietic, epithelial, and endothelial cells) and at varying levels (PMID: 32968061). Increased expression of CD147 occurs in many tumors. CD147 is a pleiotropic molecule that plays an important role in fetal, neuronal, lymphocyte and extracellular matrix development (PMID: 17945211). CD147 has been identified as a receptor essential for erythrocyte invasion by Plasmodium falciparum (PMID: 22080952). It has been reported that spike protein of SARS-CoV-2 binds to CD147 on host cells, thereby mediating the viral invasion (Wang, Ke, et al, BioRxiv, 2020).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD147 antibody 30880-1-AP | Download protocol | 
| IHC protocol for CD147 antibody 30880-1-AP | Download protocol | 
| WB protocol for CD147 antibody 30880-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 









