Product Information
60673-1-PBS targets S100A12 as part of a matched antibody pair:
MP50966-1: 60673-1-PBS capture and 60673-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9961 Product name: Recombinant human S100A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC070294 Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Predict reactive species |
| Full Name | S100 calcium binding protein A12 |
| Calculated Molecular Weight | 92 aa, 11 kDa |
| GenBank Accession Number | BC070294 |
| Gene Symbol | S100A12 |
| Gene ID (NCBI) | 6283 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P80511 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

