Product Information
60735-3-PBS targets CD84 as part of a matched antibody pair:
MP51062-2: 60735-3-PBS capture and 60735-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30126 Product name: Recombinant human CD84 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 99-190 aa of BC020063 Sequence: LRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELT Predict reactive species |
| Full Name | CD84 molecule |
| Calculated Molecular Weight | 345 aa, 39 kDa |
| GenBank Accession Number | BC020063 |
| Gene Symbol | CD84 |
| Gene ID (NCBI) | 8832 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UIB8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
