FHIT Monoclonal antibody, PBS Only (Capture)

FHIT Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 60833-1-PBS
Clone No.1F1C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60833-1-PBS targets FHIT as part of a matched antibody pair:

MP51232-1: 60833-1-PBS capture and 66086-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14471

Product name: Recombinant human FHIT protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-147 aa of BC032336

Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

Predict reactive species
Full Name fragile histidine triad gene
Calculated Molecular Weight 147 aa, 17 kDa
GenBank Accession NumberBC032336
Gene Symbol FHIT
Gene ID (NCBI) 2272
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP49789
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...