Product Information
60863-1-PBS targets TNFRSF18 as part of a matched antibody pair:
MP51275-1: 60863-1-PBS capture and 60863-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgM |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26103 Product name: Recombinant human TNFRSF18 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-130 aa of NM_004195 Sequence: QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKP Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 18 |
| Calculated Molecular Weight | 26 kDa |
| GenBank Accession Number | NM_004195 |
| Gene Symbol | TNFRSF18 |
| Gene ID (NCBI) | 8784 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Thiophilic affinity chromatograph |
| UNIPROT ID | Q9Y5U5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

