Product Information
67247-2-PBS targets C20orf30 as part of a matched antibody pair:
MP50730-1: 67247-2-PBS capture and 67247-3-PBS detection (validated in Cytometric bead array)
MP50730-2: 67247-2-PBS capture and 67247-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15080 Product name: Recombinant human C20orf30 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-120 aa of BC011990 Sequence: MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD Predict reactive species |
Full Name | chromosome 20 open reading frame 30 |
Calculated Molecular Weight | 183 aa, 20 kDa |
GenBank Accession Number | BC011990 |
Gene Symbol | TMEM230 |
Gene ID (NCBI) | 29058 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G Magarose purification |
UNIPROT ID | Q96A57 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |