Product Information
67444-2-PBS targets CD62L as part of a matched antibody pair:
MP50444-1: 67444-2-PBS capture and 67444-3-PBS detection (validated in Cytometric bead array)
MP50444-2: 67444-2-PBS capture and 67444-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29297 Product name: Recombinant human SELL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 147-300 aa of BC020758 Sequence: KRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTF Predict reactive species |
| Full Name | selectin L |
| Calculated Molecular Weight | 42 kDa |
| GenBank Accession Number | BC020758 |
| Gene Symbol | CD62L |
| Gene ID (NCBI) | 6402 |
| ENSEMBL Gene ID | ENSG00000188404 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P14151 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



