Product Information
68026-3-PBS targets FADS2-Specific as part of a matched antibody pair:
MP50824-1: 68026-2-PBS capture and 68026-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species |
| Full Name | fatty acid desaturase 2 |
| Calculated Molecular Weight | 445 aa, 49 kDa |
| GenBank Accession Number | BC009011 |
| Gene Symbol | FADS2 |
| Gene ID (NCBI) | 9415 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | O95864 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

