PHF5A Monoclonal antibody

PHF5A Monoclonal Antibody for WB, ELISA
Cat No. 68196-1-Ig
Clone No.1G7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, ELISA

bK223H9.2, INI, PHD finger protein 5A, PHF5A, SF3b14b

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68196-1-Ig targets PHF5A in WB, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7804

Product name: Recombinant human INI-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-110 aa of BC007321

Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Predict reactive species
Full Name PHD finger protein 5A
Calculated Molecular Weight 12 kDa
Observed Molecular Weight12 kDa
GenBank Accession NumberBC007321
Gene Symbol PHF5A
Gene ID (NCBI) 84844
RRIDAB_2935285
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ7RTV0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha and is involved in pre-mRNA splicing.

Protocols

Product Specific Protocols
WB protocol for PHF5A antibody 68196-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...