PHF5A Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHF5A Monoclonal antibody, PBS Only (68196-1-PBS)

• 

  WB analysis using 68196-1-Ig (same clone as 68196-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68196-1-Ig (PHF5A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 68196-1-Ig (same clone as 68196-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 68196-1-Ig (PHF5A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68196-1-PBS in a different storage buffer formulation.

PHF5A Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68196-1-PBS

Clone No.1G7E2

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

bK223H9.2, INI, PHD finger protein 5A, PHF5A, SF3b14b

---

Product Information

68196-1-PBS targets PHF5A in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7804

  Product name: Recombinant human INI-1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-110 aa of BC007321

  Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

• Full Name: PHD finger protein 5A
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC007321
• Gene Symbol: PHF5A
• Gene ID (NCBI): 84844
• RRID: AB_2935285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q7RTV0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The PHD finger-like domain protein 5a (PHF5A) is ubiquitously expressed and is located in the nucleus. The gene Phf5a and its human counterpart PHF5A (former name Ini) are located on rat chromosome 7 (RNO7q34) and human chromosome 22 (HSA2213q2), respectively. The rat gene consists of four exons, while the human gene have five exons. Both genes encode a highly conserved protein of 110 amino acids that contains a PHD finger domain.(PMID: 23675859) It acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha and is involved in pre-mRNA splicing.