Product Information
68601-2-PBS targets SLC1A4 as part of a matched antibody pair:
MP50199-1: 68601-2-PBS capture and 68601-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17328 Product name: Recombinant human SLC1A4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 431-532 aa of BC026216 Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL Predict reactive species |
| Full Name | solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 |
| Calculated Molecular Weight | 532 aa, 56 kDa |
| GenBank Accession Number | BC026216 |
| Gene Symbol | SLC1A4 |
| Gene ID (NCBI) | 6509 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P43007 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

