Product Information
68816-2-PBS targets VMAT2 as part of a matched antibody pair:
MP50190-1: 68816-1-PBS capture and 68816-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14971 Product name: Recombinant human VMAT2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-127 aa of BC108928 Sequence: VVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNE Predict reactive species |
Full Name | solute carrier family 18 (vesicular monoamine), member 2 |
Calculated Molecular Weight | 514 aa, 56 kDa |
GenBank Accession Number | BC108928 |
Gene Symbol | VMAT2 |
Gene ID (NCBI) | 6571 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q05940 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |