Product Information
68859-1-PBS targets Cytokeratin 7 as part of a matched antibody pair:
MP50253-1: 68859-1-PBS capture and 68859-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
MP50253-2: 68859-1-PBS capture and 68859-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17703 Product name: Recombinant human KRT7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-94 aa of BC002700 Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQ Predict reactive species |
Full Name | keratin 7 |
Calculated Molecular Weight | 469 aa, 51 kDa |
GenBank Accession Number | BC002700 |
Gene Symbol | Cytokeratin 7 |
Gene ID (NCBI) | 3855 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | P08729 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |