SCD Recombinant monoclonal antibody, PBS Only (Capture)

SCD Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 81468-2-PBS
Clone No.241487B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

Delta-9 desaturase, Delta(9)-desaturase, Delta(9) desaturase, Acyl-CoA desaturase, Acyl CoA desaturase

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81468-2-PBS targets SCD as part of a matched antibody pair:

MP01272-1: 81468-2-PBS capture and 81468-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29156

Product name: Recombinant human SCD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-72 aa of BC005807

Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

Predict reactive species
Full Name stearoyl-CoA desaturase (delta-9-desaturase)
Calculated Molecular Weight 355 aa, 41 kDa
Observed Molecular Weight28-42 kDa
GenBank Accession NumberBC005807
Gene Symbol SCD
Gene ID (NCBI) 6319
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00767
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).

Loading...
||
New chat Able
正在加载,请稍候...