Product Information
83036-1-RR targets SLC29A3 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18563 Product name: Recombinant human SLC29A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC120996 Sequence: MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSL Predict reactive species |
| Full Name | solute carrier family 29 (nucleoside transporters), member 3 |
| Calculated Molecular Weight | 475 aa, 52 kDa |
| Observed Molecular Weight | 51 kDa, 60 kDa |
| GenBank Accession Number | BC120996 |
| Gene Symbol | SLC29A3 |
| Gene ID (NCBI) | 55315 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BZD2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |

