Product Information
83266-3-PBS targets BUB3 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species |
Full Name | budding uninhibited by benzimidazoles 3 homolog (yeast) |
Calculated Molecular Weight | 37 kDa |
GenBank Accession Number | BC005138 |
Gene Symbol | BUB3 |
Gene ID (NCBI) | 9184 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O43684 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |