CRIP1 Recombinant monoclonal antibody, PBS Only (Detector)

CRIP1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83340-3-PBS
Clone No.240176G2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240176G2, CRHP, CRIP, CRIP 1, CRP 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83340-3-PBS targets CRIP1 as part of a matched antibody pair:

MP00382-3: 83340-4-PBS capture and 83340-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7588

Product name: Recombinant human CRIP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-77 aa of BC002738

Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK

Predict reactive species
Full Name cysteine-rich protein 1 (intestinal)
Calculated Molecular Weight 9 kDa
Observed Molecular Weight 8-9 kDa
GenBank Accession NumberBC002738
Gene Symbol CRIP1
Gene ID (NCBI) 1396
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50238
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CRIP1 also known as CRIP, CRP1, belongs to the LIM/double zinc finger protein family. CRIP1 has a unique double zinc finger motif, which is mainly expressed in the intestine, and may be involved in intestinal zinc transport (PMID: 31312368, 1946385). CRIP1 is overexpressed in immune cells of the epithelium and may play an important role in gut immunity(PMID: 27836662).

Loading...
||
New chat Able
正在加载,请稍候...