Tested Applications
| Positive WB detected in | SH-SY5Y cells, HEK-293 cells, HeLa cells, Jurkat cells, MCF-7 cells |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | A431 cells, HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83443-6-RR targets NEDD1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33603 Product name: Recombinant human NEDD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC027605 Sequence: MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAAS Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 1 |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 71-75 kDa |
| GenBank Accession Number | BC027605 |
| Gene Symbol | NEDD1 |
| Gene ID (NCBI) | 121441 |
| RRID | AB_3671084 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q8NHV4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD1 (NEDD1 gamma-tubulin ring complex targeting factor), also known as GCP-WD. It is expected to be located in centrosome; nucleoplasm; and plasma membrane. Required for mitosis progression. Promotes the nucleation of microtubules from the spindle. The molecular weight of NEDD1is 72 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NEDD1 antibody 83443-6-RR | Download protocol |
| WB protocol for NEDD1 antibody 83443-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









