Product Information
83642-1-PBS targets WFS1 as part of a matched antibody pair:
MP00629-1: 83642-1-PBS capture and 83642-3-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25735 Product name: Recombinant human WFS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-95 aa of BC030130 Sequence: MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAPAEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERA Predict reactive species |
Full Name | Wolfram syndrome 1 (wolframin) |
Calculated Molecular Weight | 890 aa, 100 kDa |
GenBank Accession Number | BC030130 |
Gene Symbol | WFS1 |
Gene ID (NCBI) | 7466 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O76024 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |