SLC4A7/NBCn1 Recombinant monoclonal antibody, PBS Only (Detector)

SLC4A7/NBCn1 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83676-2-PBS
Clone No.240689F3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

NBCn1, SLC4A7, NBC2, NBC3

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83676-2-PBS targets SLC4A7/NBCn1 as part of a matched antibody pair:

MP00654-1: 83676-3-PBS capture and 83676-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30545

Product name: Recombinant human SLC4A7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 119-237 aa of NM_003615

Sequence: LCYRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRASTLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADI

Predict reactive species
Full Name solute carrier family 4, sodium bicarbonate cotransporter, member 7
Calculated Molecular Weight 136 kDa
GenBank Accession NumberNM_003615
Gene Symbol NBCn1/SLC4A7
Gene ID (NCBI) 9497
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6M7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...