Product Information
83890-2-PBS targets 4EBP1 as part of a matched antibody pair:
MP00559-3: 83890-1-PBS capture and 83890-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species |
Full Name | eukaryotic translation initiation factor 4E binding protein 1 |
Calculated Molecular Weight | 118 aa, 12 kDa |
GenBank Accession Number | BC004459 |
Gene Symbol | EIF4EBP1 |
Gene ID (NCBI) | 1978 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13541 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |