Tested Applications
| Positive WB detected in | THP-1 cells | 
| Positive FC (Intra) detected in | A431 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84121-5-RR targets ZNF350 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Recombinant | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag23982 Product name: Recombinant human ZNF350 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 426-532 aa of BC009921 Sequence: REKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP Predict reactive species | 
                                    
| Full Name | zinc finger protein 350 | 
| Observed Molecular Weight | 60 kDa | 
| GenBank Accession Number | BC009921 | 
| Gene Symbol | ZNF350 | 
| Gene ID (NCBI) | 59348 | 
| RRID | AB_3671683 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purfication | 
| UNIPROT ID | Q9GZX5 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
ZNF350 (Zinc finger protein 350), also known as zinc-finger and BRCA1-interacting protein with a Kruppel-associated box (KRAB) domain (ZBRK1), is involved in the development of several human tumor types, including breast, colon, and cervical carcinomas. ZNF350 has been identified as a transcriptional suppressor that can either form complexes with other proteins or play a direct transcriptional suppressive role in a single-factor form (PMID: 30613364). Overexpression of ZBRK1 has the potential to inhibit cancer cell migration and suppress metastasis activity suggesting that ZBRK1 may behave as a metastasis suppressor (PMID: 19996286).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ZNF350 antibody 84121-5-RR | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 





