Tested Applications
Positive WB detected in | MCF-7 cells, T-47D cells |
Positive IHC detected in | human ovary cancer tissue, human breast cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:250-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
84564-4-RR targets ER in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg2234 Product name: Recombinant Human ER protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-116 aa of BC128573 Sequence: MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ Predict reactive species |
Full Name | estrogen receptor 1 |
Calculated Molecular Weight | 595 aa, 66 kDa |
Observed Molecular Weight | 66 kDa |
GenBank Accession Number | BC128573 |
Gene Symbol | ER |
Gene ID (NCBI) | 2099 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | P03372 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The estrogen receptor (ESR, ER) is a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. ESR1, also known as ESR or NR3A1, belongs to the nuclear hormone receptor family and NR3 subfamily. It is a nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. ESR1 can activate the transcriptional activity of TFF1.[PMID: 11731608,10970861]
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ER antibody 84564-4-RR | Download protocol |
IHC protocol for ER antibody 84564-4-RR | Download protocol |
IF protocol for ER antibody 84564-4-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |