Product Information
84598-3-PBS targets CD164 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1690 Product name: Recombinant Human CD164 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-162 aa of NM_006016.6 Sequence: DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD Predict reactive species |
| Full Name | CD164 molecule, sialomucin |
| Calculated Molecular Weight | 21kDa |
| GenBank Accession Number | NM_006016.6 |
| Gene Symbol | CD164 |
| Gene ID (NCBI) | 8763 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04900-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
