• Featured Product
  • KD/KO Validated

PSMD14/POH1 Recombinant monoclonal antibody

PSMD14/POH1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84767-3-RR
Clone No.242160E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

PSMD14, 242160E7, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome-associated PAD1 homolog 1, EC:3.4.19.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, K-562 cells, HeLa cells, MCF-7 cells, NIH/3T3 cells, mouse heart tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84767-3-RR targets PSMD14/POH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2694

Product name: Recombinant human PSMD14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-95 aa of BC009524

Sequence: MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Calculated Molecular Weight 35 kDa
Observed Molecular Weight33 kDa
GenBank Accession NumberBC009524
Gene Symbol PSMD14
Gene ID (NCBI) 10213
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00487
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The PSMD14 (POH1, also known as Rpn11/MPR1/S13/CepP1) protein is a metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. PSMD14 is highly expressed in the heart and skeletal muscle. In carcinoma cell lines. down-regulation of PSMD14 by siRNA transfection had a considerable impact on cell viability causing cell arrest in the G0-G1 phase, ultimately leading to senescence.

Protocols

Product Specific Protocols
IF protocol for PSMD14/POH1 antibody 84767-3-RRDownload protocol
IHC protocol for PSMD14/POH1 antibody 84767-3-RRDownload protocol
WB protocol for PSMD14/POH1 antibody 84767-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...