IL-1RA/IL-1RN Recombinant monoclonal antibody

IL-1RA/IL-1RN Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85672-3-RR
Clone No.242317D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

IL1 inhibitor, IL1RA, IL-1ra, Il1rn, IL-1RN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC2C12 cells, mouse skin tissues
Positive IHC detected inmouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85672-3-RR targets IL-1RA/IL-1RN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3206

Product name: Recombinant Rat IL-1RA protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 27-178 aa of NM_022194.2

Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ

Predict reactive species
Full Name interleukin 1 receptor antagonist
Calculated Molecular Weight20 kDa
Observed Molecular Weight18-20 kDa
GenBank Accession NumberNM_022194.2
Gene Symbol Il1rn
Gene ID (NCBI) 60582
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25086
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects.

Protocols

Product Specific Protocols
IHC protocol for IL-1RA/IL-1RN antibody 85672-3-RRDownload protocol
WB protocol for IL-1RA/IL-1RN antibody 85672-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...