Mouse FAM3D Recombinant monoclonal antibody, PBS Only (Detector)

FAM3D Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 86090-1-PBS
Clone No.250561F4

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Oit1, Oncoprotein-induced protein 1, Protein EF-7, Protein FAM3D

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86090-1-PBS targets FAM3D as part of a matched antibody pair:

MP02761-1: 86090-4-PBS capture and 86090-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2694

Product name: Recombinant Mouse Oit1 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-223 aa of NM_146050.2

Sequence: YTSFSRKTIRLPRWLGITPKDIQTPKSKCGLSKICPNNFFAFKISSGAANVVGPSMCFEDEIIMSPVRNNVGRGLNVALVNGSTGQVMKKDSFDMYSGDPQLLLNFLTEIPDSTLVLVASYDDPGTKMNDKIKTLFSNLGSSYAKQLGFRDSWVFVGAKDLKSKSPYEQFLKNNPETNKYDGWPELLELEGCVPRKVM

Predict reactive species
Full Name oncoprotein induced transcript 1
Calculated Molecular Weight25 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_146050.2
Gene Symbol Oit1
Gene ID (NCBI) 18300
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP97805
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FAM3D (family with sequence similarity 3, member D) is a protein that belongs to the FAM3 family, which is a novel cytokine-like gene family identified in 2002. This family comprises four members: FAM3A, FAM3B, FAM3C, and FAM3D. FAM3D is a gut-secreted protein that is regulated by nutritional status. It has a predicted secondary structure of a four-helix bundle, which is a common feature in many other cytokines.

Loading...
||
New chat

Able

正在加载,请稍候...