Product Information
87064-1-PBS targets Btc as part of a matched antibody pair:
MP02843-1: 87064-2-PBS capture and 87064-1-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2895 Product name: Recombinant Mouse Betacellulin/BTC protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 32-118 aa of NM_007568.5 Sequence: DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQ Predict reactive species |
| Full Name | betacellulin, epidermal growth factor family member |
| Calculated Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_007568.5 |
| Gene Symbol | Btc |
| Gene ID (NCBI) | 12223 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q543J8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



