Product Information
83890-3-PBS targets 4EBP1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4E binding protein 1 |
| Calculated Molecular Weight | 118 aa, 12 kDa |
| GenBank Accession Number | BC004459 |
| Gene Symbol | EIF4EBP1 |
| Gene ID (NCBI) | 1978 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13541 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
