Product Information
83890-4-PBS targets 4EBP1 in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag5056 Product name: Recombinant human 4EBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC004459 Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Predict reactive species |
Full Name | eukaryotic translation initiation factor 4E binding protein 1 |
Calculated Molecular Weight | 118 aa, 12 kDa |
GenBank Accession Number | BC004459 |
Gene Symbol | EIF4EBP1 |
Gene ID (NCBI) | 1978 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q13541 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |