AADACL1 Polyclonal antibody, PBS Only

• 

  WB analysis using 14021-1-AP (same clone as 14021-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14021-1-AP (AADACL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IP experiment of COLO 320 using 14021-1-AP (same clone as 14021-1-PBS)

  IP result of anti-AADACL1 (IP:14021-1-AP, 4ug; Detection:14021-1-AP 1:500) with COLO 320 cells lysate 1320 ug. This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 14021-1-AP (same clone as 14021-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 14021-1-AP (AADACL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

• 

  IF Staining of COLO 320 using 14021-1-AP (same clone as 14021-1-PBS)

  Immunofluorescent analysis of COLO 320 cells using 14021-1-AP (AADACL1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14021-1-PBS in a different storage buffer formulation.

AADACL1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14021-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

14021-1-PBS targets AADACL1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5136

  Product name: Recombinant human AADACL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 83-435 aa of BC047588

  Sequence: SHHLLALNFIIVSFGKKSAWSSAKVKVTDTDFDGVEVRVFEGPPKPEEPLKRSVVYIHGGGWALASAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPEQIHDVVRATKYFLKPEVLQKYMVDPGRICISGDSAGGNLAAALGQQFTQDASLKNKLKLQALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYIMTCEHDVLRDDGIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL

• Full Name: arylacetamide deacetylase-like 1
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC047588
• Gene Symbol: AADACL1
• Gene ID (NCBI): 57552
• RRID: AB_2034888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PIU2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AADACL1(Arylacetamide deacetylase-like 1) is also named as NCEH1, KIAA1363 and belongs to the 'GDXG' lipolytic enzyme family. The transmembrane enzyme, AADACL1, controls the production of the monoalkylglycerol ether (MAGE) class of NELs in cancer cells and acts as a 2-acetyl MAGE hydrolase and is likely the principal source for this activity in tumor cells(PMID:21513884). The full length protein has three glycosylation sites and can be N-glycosylated(PMID:19159218). It has 3 isoforms produced by alternative splicing.