ABCA9 Polyclonal antibody, PBS Only

• 

  WB analysis using 31194-1-AP (same clone as 31194-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31194-1-AP (ABCA9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31194-1-PBS in a different storage buffer formulation.

ABCA9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31194-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EST640918

---

Product Information

31194-1-PBS targets ABCA9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35032

  Product name: Recombinant human ABCA9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-183 aa of BC167781

  Sequence: HQVHDTPQMSSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLNYSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVAFQA

• Full Name: ATP-binding cassette, sub-family A (ABC1), member 9
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC167781
• Gene Symbol: ABCA9
• Gene ID (NCBI): 10350
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IUA7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP-binding cassette subfamily A member 9 (ABCA9) belongs to the superfamily of ATP-binding cassette (ABC) transporters and contains two transmembrane domains and two nucleotide-binding folds. It has 5 isoforms and may play a role in monocyte differentiation and lipid transport and homeostasis.