ABCC6 Polyclonal antibody

• 

  WB analysis of mouse liver using 27848-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27848-1-AP (ABCC6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 27848-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27848-1-AP (ABCC6 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 27848-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27848-1-AP (ABCC6 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ABCC6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27848-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

ABC34, ABCC6, ARA, EST349056, MLP1, MOAT E, MOATE, MRP6, PXE, PXE1

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 3 publications below
• IF: See 2 publications below

Product Information

27848-1-AP targets ABCC6 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18640

  Product name: Recombinant human ABCC6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1219-1503 aa of BC131732

  Sequence: VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV

• Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 6
• Calculated Molecular Weight: 1503 aa, 165 kDa
• Observed Molecular Weight: 165 kDa and 96 kDa
• GenBank Accession Number: BC131732
• Gene Symbol: ABCC6
• Gene ID (NCBI): 368
• RRID: AB_2880992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95255
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ATP-binding cassette transporter 6 (ABCC6) gene, also named as MRP6, is a cellular transmembrane protein transporter and belongs to ATP-binding cassette (ABC) family. ABCC6 is an ATP-dependent transporter contains two ATP-binding domains. It is mainly found in the liver, the proximal tubules of the kidneys and the intestines. ABCC6 is involved in a pathway of extracellular nucleotide metabolism and the regulation of tissue calcification. Mutations of ABCC6 leads to pseudoxanthoma elasticum (PXE) which is a rare autosomal recessive disorder. Mutations of ABCC6 can also lead generalized arterial calcification of infancy-2 (GACI2). 27848-1-AP detects two isoforms of ABCC6 protein around 165 kDa and 96 kDa in SDS-PAGE.(PMID:28891970, 29709427, 29662086, 15888484)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Front Oncol; ABCC6 Knockdown Fuels Cell Proliferation by Regulating PPARα in Hepatocellular Carcinoma.; Authors - Zhicong Zhao
human	IF	Front Cardiovasc Med; A Novel Idiopathic Atrial Calcification: Pathologic Manifestations and Potential Mechanism.; Authors - Bowen Li
human	IHC	Front Genet; Clinical Significance and Potential Mechanisms of ATP Binding Cassette Subfamily C Genes in Hepatocellular Carcinoma.; Authors - Xin Zhou
human	WB	Oncol Lett; Effects of histone deacetylase inhibitors on ATP-binding cassette transporters in lung cancer A549 and colorectal cancer HCT116 cells.; Authors - Hao Wang
human	WB,IHC,IF	Cells; CircZXDC Promotes Vascular Smooth Muscle Cell Transdifferentiation via Regulating miRNA-125a-3p/ABCC6 in Moyamoya Disease; Authors - Yuan Liu