ABCC6 Polyclonal antibody

ABCC6 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 27848-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse and More (1)

Applications

WB, IF, IHC, ELISA

ABC34, ABCC6, ARA, EST349056, MLP1, MOAT E, MOATE, MRP6, PXE, PXE1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27848-1-AP targets ABCC6 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18640

Product name: Recombinant human ABCC6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1219-1503 aa of BC131732

Sequence: VVRNWTDLENSIVSVERMQDYAWTPKEAPWRLPTCAAQPPWPQGGQIEFRDFGLRYRPELPLAVQGVSFKIHAGEKVGIVGRTGAGKSSLASGLLRLQEAAEGGIWIDGVPIAHVGLHTLRSRISIIPQDPILFPGSLRMNLDLLQEHSDEAIWAALETVQLKALVASLPGQLQYKCADRGEDLSVGQKQLLCLARALLRKTQILILDEATAAVDPGTELQMQAMLGSWFAQCTVLLIAHRLRSVMDCARVLVMDKGQVAESGSPAQLLAQKGLFYRLAQESGLV

Predict reactive species
Full Name ATP-binding cassette, sub-family C (CFTR/MRP), member 6
Calculated Molecular Weight 1503 aa, 165 kDa
Observed Molecular Weight 165 kDa and 96 kDa
GenBank Accession NumberBC131732
Gene Symbol ABCC6
Gene ID (NCBI) 368
RRIDAB_2880992
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95255
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ATP-binding cassette transporter 6 (ABCC6) gene, also named as MRP6, is a cellular transmembrane protein transporter and belongs to ATP-binding cassette (ABC) family. ABCC6 is an ATP-dependent transporter contains two ATP-binding domains. It is mainly found in the liver, the proximal tubules of the kidneys and the intestines. ABCC6 is involved in a pathway of extracellular nucleotide metabolism and the regulation of tissue calcification. Mutations of ABCC6 leads to pseudoxanthoma elasticum (PXE) which is a rare autosomal recessive disorder. Mutations of ABCC6 can also lead generalized arterial calcification of infancy-2 (GACI2). 27848-1-AP detects two isoforms of ABCC6 protein around 165 kDa and 96 kDa in SDS-PAGE.(PMID:28891970, 29709427, 29662086, 15888484)

Protocols

Product Specific Protocols
IHC protocol for ABCC6 antibody 27848-1-APDownload protocol
WB protocol for ABCC6 antibody 27848-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Front Oncol

ABCC6 Knockdown Fuels Cell Proliferation by Regulating PPARα in Hepatocellular Carcinoma.

Authors - Zhicong Zhao
humanIF

Front Cardiovasc Med

A Novel Idiopathic Atrial Calcification: Pathologic Manifestations and Potential Mechanism.

Authors - Bowen Li
humanIHC

Front Genet

Clinical Significance and Potential Mechanisms of ATP Binding Cassette Subfamily C Genes in Hepatocellular Carcinoma.

Authors - Xin Zhou
humanWB

Oncol Lett

Effects of histone deacetylase inhibitors on ATP-binding cassette transporters in lung cancer A549 and colorectal cancer HCT116 cells.

Authors - Hao Wang
humanWB,IHC,IF

Cells

CircZXDC Promotes Vascular Smooth Muscle Cell Transdifferentiation via Regulating miRNA-125a-3p/ABCC6 in Moyamoya Disease

Authors - Yuan Liu
Loading...
||
New chat Able
正在加载,请稍候...