Product Information
32036-1-PBS targets ABHD4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36373 Product name: Recombinant human ABHD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 250-342 aa of BC024779 Sequence: PSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD Predict reactive species |
| Full Name | abhydrolase domain containing 4 |
| Calculated Molecular Weight | 342 aa, 39 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC024779 |
| Gene Symbol | ABHD4 |
| Gene ID (NCBI) | 63874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8TB40 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The alpha/beta hydrolase structural domain-containing protein 4 (ABHD4) gene is a major regulator of mammalian phospholipid metabolism with hydrolase and lysophospholipase activities. ABHD4 is involved in anoikis resistance and endogenous cannabinoid biosynthesis, and ABHD4-mediated developmental anoikis specifically protects embryonic brains from the consequences of sporadic delamination errors and teratogenic damage.



