ACAD8 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86742-2-RR (same clone as 86742-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86742-2-RR (ACAD8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86742-2-PBS in a different storage buffer formulation.

ACAD8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86742-2-PBS

Clone No.251392B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ACAD 8, ACAD-8, Activator-recruited cofactor 42 kDa component, Acyl-CoA dehydrogenase family member 8, ARC42

---

Product Information

86742-2-PBS targets ACAD8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9967

  Product name: Recombinant human ACAD8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-415 aa of BC001964

  Sequence: MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGLGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

• Full Name: acyl-Coenzyme A dehydrogenase family, member 8
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC001964
• Gene Symbol: ACAD8
• Gene ID (NCBI): 27034
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UKU7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The acyl-CoA dehydrogenases (ACAD) (EC 1.3.99) are a family of nuclear-encoded mitochondrial enzymes involved in the metabolism of fatty acids and branched chain amino acids (PMID: 13295225). The eighth member of this family, ACAD8, catalyzes the conversion of isobutyryl-CoA to methacrylyl-CoA in valine catabolism (PMID: 12359132).