• Featured Product
  • KD/KO Validated

ACE2 Polyclonal antibody

ACE2 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA
Cat No. 21115-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA

ACE related carboxypeptidase, ACEH, ACE-related carboxypeptidase, Angiotensin converting enzyme 2, Angiotensin-converting enzyme 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, human skeletal muscle tissue
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman kidney tissue, mouse testis tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman kidney tissue, mouse kidney tissue
Positive IF-Fro detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21115-1-AP targets ACE2 in WB, IHC, IF-P, IF-Fro, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15455

Product name: Recombinant human ACE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 392-744 aa of BC048094

Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI

Predict reactive species
Full Name angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Calculated Molecular Weight 805 aa, 92 kDa
Observed Molecular Weight 120 kDa, 92 kDa
GenBank Accession NumberBC048094
Gene Symbol ACE2
Gene ID (NCBI) 59272
RRIDAB_10732845
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BYF1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).

Protocols

Product Specific Protocols
IF protocol for ACE2 antibody 21115-1-APDownload protocol
IHC protocol for ACE2 antibody 21115-1-APDownload protocol
IP protocol for ACE2 antibody 21115-1-APDownload protocol
WB protocol for ACE2 antibody 21115-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Genet

Bidirectional genome-wide CRISPR screens reveal host factors regulating SARS-CoV-2, MERS-CoV and seasonal HCoVs

Authors - Antoine Rebendenne
humanIF

Cell Stem Cell

Androgen Signaling Regulates SARS-CoV-2 Receptor Levels and Is Associated with Severe COVID-19 Symptoms in Men.

Authors - Ryan M Samuel
human,mouseIF

Cell Res

Receptome profiling identifies KREMEN1 and ASGR1 as alternative functional receptors of SARS-CoV-2.

Authors - Yunqing Gu
humanIHC

Nat Neurosci

Olfactory transmucosal SARS-CoV-2 invasion as a port of central nervous system entry in individuals with COVID-19.

Authors - Jenny Meinhardt
humanWB

Nat Commun

Evolution of Omicron lineage towards increased fitness in the upper respiratory tract in the absence of severe lung pathology

Authors - Arthur Wickenhagen
humanWB,FC

Mol Cell

Enhanced SARS-CoV-2 entry via UPR-dependent AMPK-related kinase NUAK2

Authors - Vibhu Prasad

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Magdalena (Verified Customer) (07-18-2022)

I'm satisfied with this antibody. I used this antibody in dot-blot technique and IF. In IF I used dilution factor 1:200, seconday antibody was alexa fluor 555.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:200
FH

Ratna (Verified Customer) (01-14-2021)

Good

  • Applications: Western Blot
Loading...
||
New chat Able
正在加载,请稍候...