• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated ACE2 Polyclonal antibody

ACE2 Polyclonal Antibody for IF-P

Cat No. CL594-21115

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF-P

ACE related carboxypeptidase, ACEH, ACE-related carboxypeptidase, Angiotensin converting enzyme 2, Angiotensin-converting enzyme 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-21115 targets ACE2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15455

Product name: Recombinant human ACE2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 392-744 aa of BC048094

Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI

Predict reactive species
Full Name angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Calculated Molecular Weight 805 aa, 92 kDa
Observed Molecular Weight 120 kDa, 92 kDa
GenBank Accession NumberBC048094
Gene Symbol ACE2
Gene ID (NCBI) 59272
RRIDAB_2919858
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BYF1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).

Protocols

Product Specific Protocols
IF protocol for CL594 ACE2 antibody CL594-21115Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...