Tested Applications
Positive WB detected in | human testis tissue, human skeletal muscle tissue |
Positive IHC detected in | human small intestine tissue, human colon tissue, human colon cancer tissue, human kidney tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | human kidney tissue, mouse testis tissue, mouse heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 25 publications below |
IHC | See 5 publications below |
IF | See 12 publications below |
IP | See 1 publications below |
FC | See 1 publications below |
Product Information
66699-1-Ig targets ACE2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, monkey |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag15554 Product name: Recombinant human ACE2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 392-744 aa of BC048094 Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI Predict reactive species |
Full Name | angiotensin I converting enzyme (peptidyl-dipeptidase A) 2 |
Calculated Molecular Weight | 805 aa, 92 kDa |
Observed Molecular Weight | 120 kDa, 92 kDa |
GenBank Accession Number | BC048094 |
Gene Symbol | ACE2 |
Gene ID (NCBI) | 59272 |
RRID | AB_2882052 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q9BYF1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for ACE2 antibody 66699-1-Ig | Download protocol |
IHC protocol for ACE2 antibody 66699-1-Ig | Download protocol |
WB protocol for ACE2 antibody 66699-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Stem Cell Androgen Signaling Regulates SARS-CoV-2 Receptor Levels and Is Associated with Severe COVID-19 Symptoms in Men. | ||
Ocul Surf SARS-CoV-2 receptor ACE2 is expressed in human conjunctival tissue, especially in diseased conjunctival tissue. | ||
Cell Death Differ SARS-CoV-2 spike protein dictates syncytium-mediated lymphocyte elimination. | ||
J Control Release Peritoneal M2 macrophage-derived extracellular vesicles as natural multitarget nanotherapeutics to attenuate cytokine storms after severe infections. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Lindsey (Verified Customer) (05-24-2021) | Great antibody---looking forward to trying the RabPolyAb as well
![]() |
FH Lindsey (Verified Customer) (09-21-2020) | Perfomed IF analysis on human FFPE and mouse frozen tissue sections; for FFPE tissue, antigen retrieval was performed for 30 min at 95C using Tris EDTA Buffer (pH9.0); Permeabilization was not performed; Blocking was performed using 5% Normal Serum and 0.3% TritonX-100 for 30. minutes at room temperature. Mouse lung sections were costained with ARL13B (Proteintech #1711-1-AP) to visualize primary cilia of the lung epithelia; all sections were counterstained with DAPI Fluormount (Abcam); image attached is of mouse lung frozen tissue; due to size restrictions I am limited to this image only but am happy to provide additional images (human tissue etc.) upon request
![]() |