CoraLite®594-conjugated ACE2 Monoclonal antibody

• 

  IF Staining of human kidney using CL594-66699

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using CoraLite®594 ACE2 antibody (CL594-66699, Clone: 2F12A4 ) at dilution of 1:200.

• 

  IF Staining of human kidney using CL594-66699

  Immunofluorescent analysis of (4% PFA) fixed human kidney tissue using CoraLite®594 ACE2 antibody (CL594-66699, Clone: 2F12A4 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

ACE2 Monoclonal Antibody for IF-P

Cat No. CL594-66699

Clone No.2F12A4

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

Synonyms

ACE related carboxypeptidase, ACE2, ACEH, DKFZp434A014, Metalloprotease MPROT15

---

Tested Applications

• Positive IF-P detected in: human kidney tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66699 targets ACE2 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15554

  Product name: Recombinant human ACE2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 392-744 aa of BC048094

  Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI

• Full Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
• Calculated Molecular Weight: 805 aa, 92 kDa
• GenBank Accession Number: BC048094
• Gene Symbol: ACE2
• Gene ID (NCBI): 59272
• RRID: AB_2920024
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9BYF1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2.