• Featured Product
  • KD/KO Validated

ACK1 Polyclonal antibody, PBS Only

ACK1 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 14304-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

TNK2, ACK, ACK 1, ACK-1, Activated CDC42 kinase 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14304-1-PBS targets ACK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5419

Product name: Recombinant human ACK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-385 aa of BC028164

Sequence: MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFL

Predict reactive species
Full Name tyrosine kinase, non-receptor, 2
Calculated Molecular Weight 115 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC028164
Gene Symbol TNK2
Gene ID (NCBI) 10188
RRIDAB_11041713
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07912
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TNK2, also named ACK1, belongs to the protein kinase superfamily and Tyr protein kinase family. It is a non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, and cell proliferation. TNK2 transduces extracellular signals to cytosolic and nuclear effectors. It is a downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. TNK2 confers metastatic properties on cancer cells by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. The 60-70kd band is the isoform 2 of TNK2. Isoform 1 and 3 is about 120-125kd.

Loading...
||
New chat Able
正在加载,请稍候...