ACK1 Polyclonal antibody, PBS Only

• 

  WB analysis of A549 using 14304-1-AP (same clone as 14304-1-PBS)

  WB result of ACK1 antibody (14304-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACK1 transfected A549 cells. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 14304-1-AP (same clone as 14304-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 14304-1-AP (same clone as 14304-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 14304-1-AP (same clone as 14304-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 14304-1-AP (same clone as 14304-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14304-1-AP (same clone as 14304-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14304-1-AP (same clone as 14304-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14304-1-AP (ACK1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 14304-1-AP (same clone as 14304-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14304-1-AP (ACK1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 14304-1-AP (same clone as 14304-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14304-1-AP (ACK1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14304-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ACK1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14304-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

TNK2, ACK, ACK 1, ACK-1, Activated CDC42 kinase 1

---

Product Information

14304-1-PBS targets ACK1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5419

  Product name: Recombinant human ACK1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-385 aa of BC028164

  Sequence: MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFL

• Full Name: tyrosine kinase, non-receptor, 2
• Calculated Molecular Weight: 115 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC028164
• Gene Symbol: TNK2
• Gene ID (NCBI): 10188
• RRID: AB_11041713
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q07912
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNK2, also named ACK1, belongs to the protein kinase superfamily and Tyr protein kinase family. It is a non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, and cell proliferation. TNK2 transduces extracellular signals to cytosolic and nuclear effectors. It is a downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. TNK2 confers metastatic properties on cancer cells by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. The 60-70kd band is the isoform 2 of TNK2. Isoform 1 and 3 is about 120-125kd.