ACMSD Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ACMSD Recombinant monoclonal antibody, PBS Only (84100-3-PBS)

• 

  WB analysis of HEK-293 using 84100-3-RR (same clone as 84100-3-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 84100-3-RR (ACMSD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84100-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 84100-3-RR (same clone as 84100-3-PBS)

  WB result of ACMSD antibody (84100-3-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACMSD transfected HEK-293 cells. This data was developed using the same antibody clone with 84100-3-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 84100-3-RR (same clone as 84100-3-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug ACMSD Recombinant antibody (84100-3-RR, Clone:241077D5) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 84100-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84100-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84100-3-RR against Human ACMSD were performed. The affinity constant is 3.49 nM.

ACMSD Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 84100-3-PBS

Clone No.241077D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

241077D5, 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase, EC:4.1.1.45

---

Product Information

84100-3-PBS targets ACMSD in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25212

  Product name: Recombinant human ACMSD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 47-252 aa of BC016018

  Sequence: VSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEPGKLIESMEE

• Full Name: aminocarboxymuconate semialdehyde decarboxylase
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC016018
• Gene Symbol: ACMSD
• Gene ID (NCBI): 130013
• RRID: AB_3671665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8TDX5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ACMSD (alpha-amino-beta-carboxy-muconate-semialdehyde decarboxylase ) is the key enzyme that regulates the de novo NAD+ synthesis from tryptophan. ACMSD is highly expressed in the liver, kidney and to a lower degree in brain under physiological conditions. The enzyme is primarily cytosolic and is positioned at a critical branching point in the kynurenine pathway, wherein it influences the fate of the precursor 2-amino-3-carboxymuconic-6-semialdehyde (ACMS).