Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue, rat lung tissue, human pancreas cancer tissue, mouse small intestine tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15708-1-AP targets ACSL5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8258 Product name: Recombinant human ACSL5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 388-739 aa of BC007985 Sequence: DIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD Predict reactive species |
| Full Name | acyl-CoA synthetase long-chain family member 5 |
| Calculated Molecular Weight | 76 kDa |
| Observed Molecular Weight | 66-70 kDa |
| GenBank Accession Number | BC007985 |
| Gene Symbol | ACSL5 |
| Gene ID (NCBI) | 51703 |
| RRID | AB_2257881 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9ULC5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Acyl-CoA synthetase 5, a member of the ACSL gene family that catalyzes the activation of long-chain fatty acids for lipid biosynthesis, is the only ACSL isoform that is both, located on mitochondria and functionally involved in enterocyte apoptosis.ACSL5 could play a role in promoting fatty acid-induced lipoapoptosis in hepatocytes as important mechanism in fatty liver-related disorders(PMID:20470896). ACSL5 is most abundant in liver, brown adipose tissue, and intestine and is located on both the mitochondrial membrane and endoplasmic reticulum(PMID:20798351). It has 3 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ACSL5 antibody 15708-1-AP | Download protocol |
| IP protocol for ACSL5 antibody 15708-1-AP | Download protocol |
| WB protocol for ACSL5 antibody 15708-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
ACSL5 Polyclonal antibody (Cat# 15708-1-AP) has accumulated 28 citations published across 26 journals, including Nature Metabolism, Nature Communications, Cell Metabolism, Immunity, Molecular Cell, Science Advances, Cell Discovery, and Journal of Experimental & Clinical Cancer Research. Associated research fields encompass lipid and fatty acid metabolism, obesity, non-alcoholic fatty liver disease, multiple cancer types (esophageal, colorectal, myeloma, glioma, osteosarcoma), ferroptosis, inflammation, and metabolic reprogramming.
| Species | Application | Title |
|---|---|---|
Cell Metab AIDA Selectively Mediates Downregulation of Fat Synthesis Enzymes by ERAD to Retard Intestinal Fat Absorption and Prevent Obesity. | ||
Immunity Alarmin-loaded extracellular lipid droplets induce airway neutrophil infiltration during type 2 inflammation | ||
Nat Metab N6-methyladenosine (m6A) in 18S rRNA promotes fatty acid metabolism and oncogenic transformation | ||
Nat Commun Attenuated growth factor signaling during cell death initiation sensitizes membranes towards peroxidation | ||
Nat Commun p38 mediated ACSL4 phosphorylation drives stress-induced esophageal squamous cell carcinoma growth through Src myristoylation | ||
Nat Commun Tip60-mediated lipin 1 acetylation and ER translocation determine triacylglycerol synthesis rate. |
Reviews
What customers say
All five reviews are 5-star ratings. Users report excellent performance in both Western Blot and IHC applications. For WB, one user found it works well at 1:6000 on mouse samples, while another described it as "very selective and sensitive" at 1:1000 in HCT116 cells during a knock-down study. For IHC, multiple users confirmed reliable results at 1:100 on liver and mouse tissues, with comments like "best for IHC." Overall, customers consistently highlight the antibody's strong specificity, sensitivity, and ease of use across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bruna (Verified Customer) (06-18-2026) | Works good at 1:6000
 |
MALLIKARJUNA (Verified Customer) (11-13-2025) | works good for IHC
|
MALLIKARJUNA (Verified Customer) (10-24-2025) | WORKS WELL FOR IHC
|
MALLIKARJUNA (Verified Customer) (10-17-2025) | BEST FOR IHC
|
Sun (Verified Customer) (01-05-2023) | We tested this antibody in our knock-down study.Very selective and sensitive antibody.
|
