ACSS3 Polyclonal antibody

• 

  WB analysis using 16204-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16204-1-AP (ACSS3 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 16204-1-AP

  WB result of ACSS3 antibody (16204-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ACSS3 transfected HepG2 cells.

• 

  IHC staining of human liver using 16204-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16204-1-AP (ACSS3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 16204-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16204-1-AP (ACSS3 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of U2OS using 16204-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ACSS3 antibody (16204-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of U2OS using 16204-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ACSS3 antibody (16204-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

ACSS3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16204-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:6.2.1.17, EC:6.2.1.1, Acyl-CoA synthetase short-chain family member 3, mitochondrial, Acyl-CoA synthetase short-chain family member 3, ACSS 3

---

Tested Applications

• Positive WB detected in: HepG2 cells, mouse kidney tissue, rat kidney tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 8 publications below
• IHC: See 2 publications below

Product Information

16204-1-AP targets ACSS3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9173

  Product name: Recombinant human ACSS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 341-686 aa of BC009317

  Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA

• Full Name: acyl-CoA synthetase short-chain family member 3
• Calculated Molecular Weight: 686 aa, 75 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC009317
• Gene Symbol: ACSS3
• Gene ID (NCBI): 79611
• RRID: AB_2257893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6R3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACSS3(acyl-CoA synthetase short-chain family member 3, mitochondrial) belongs to the ATP-dependent AMP-binding enzyme family. It activates acetate so that it can be used for lipid synthesis or for energy generation. The deduced 686-amino acid protein contains 4 of 5 motifs characteristic of acyl-CoA synthetases. This protein has 2 isoforms produced by alternative splicing. The full length protein has a transit peptide with 29 amino acids.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Metab; Amelioration of nonalcoholic fatty liver disease by inhibiting the deubiquitylating enzyme RPN11; Authors - Bing Zhou
human,mouse	WB,IHC	Cancer Commun (Lond); Blockage of EGFR/AKT and mevalonate pathways synergize the antitumor effect of temozolomide by reprogramming energy metabolism in glioblastoma; Authors - Xiaoteng Cui
	WB	Nat Commun; ACSS2 protects against alcohol-induced hepatocyte ferroptosis through regulation of hepcidin expression; Authors - Mengyao Wang
mouse	WB	Nutrients; Effect of Microbial Status on Hepatic Odd-Chain Fatty Acids Is Diet-Dependent.; Authors - Karolin Weitkunat
human,mouse	WB	Biochem J; NRF2/ACSS2 axis mediates the metabolic effect of alcohol drinking on esophageal squamous cell carcinoma.; Authors - Joab Otieno Odera
human	WB	Cancer Genet; Prognosis prediction and drug guidance of ovarian serous cystadenocarcinoma through mitochondria gene-based model; Authors - Dongsheng Shen