ACSS3 Recombinant monoclonal antibody, PBS Only (Capture)

ACSS3 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84810-1-PBS
Clone No.242423D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Acetate--CoA ligase 3, ACSS 3, Acyl-CoA synthetase short-chain family member 3, Acyl-CoA synthetase short-chain family member 3, mitochondrial, EC:6.2.1.1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84810-1-PBS targets ACSS3 as part of a matched antibody pair:

MP01574-1: 84810-1-PBS capture and 84810-2-PBS detection (validated in Cytometric bead array)

MP01574-2: 84810-1-PBS capture and 84810-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9173

Product name: Recombinant human ACSS3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 341-686 aa of BC009317

Sequence: DLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA

Predict reactive species
Full Name acyl-CoA synthetase short-chain family member 3
Calculated Molecular Weight 686 aa, 75 kDa
GenBank Accession NumberBC009317
Gene Symbol ACSS3
Gene ID (NCBI) 79611
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H6R3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...